PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C017178P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Dof
Protein Properties Length: 470aa    MW: 51424.4 Da    PI: 5.5554
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C017178P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.1e-39119179262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k+l+cprC+s++tkfCyynny+++qPr+fCkaC+ryWt+GG++rnvPvG+grrknk+s 
  MELO3C017178P1 119 PDKILPCPRCNSMETKFCYYNNYNVNQPRHFCKACQRYWTEGGTMRNVPVGAGRRKNKNSA 179
                     7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-31115176IPR003851Zinc finger, Dof-type
PfamPF027012.9E-32121177IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.733123177IPR003851Zinc finger, Dof-type
PROSITE patternPS013610125161IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MLEIKDPPIK IFGKEIQLPP DCELSFIESD DDDDHSDSFS DKQPGDGALP KDVGKASESS  60
AAKEETLHDS EDSACVQTAN EAHMNPEVVS MDENDKLETG KPEKEQNDAP NSKEKLKKPD  120
KILPCPRCNS METKFCYYNN YNVNQPRHFC KACQRYWTEG GTMRNVPVGA GRRKNKNSAS  180
HYRQITISEA LQAAQIDVPN GVNCLATKSN GRVLNFSVNA PVCESMSTVL NPTGRKVLNG  240
TRNEFYRPDD QGIKAPCKGG ETGDECSSAS SVTMSSSMEE GARRCPQEPQ MQNINGFPPQ  300
IPYLPSVPWP CSWNAPVPPP TFCPPGVPLP FYPATYWSCG VPGAWNIPWF PPQPCSQNSG  360
ANSPTLGKHS RDGGDKLQAD NSEKEEPPKQ KNGSVLIPKT LRIDDPNEAA KSSIWETLGI  420
KNDSIKAVDL SKVFQSKGEQ KNSVSEVLSP VLQANPAALS RSRTFHERS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818130.0LN681813.1 Cucumis melo genomic scaffold, anchoredscaffold00030.
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008453209.10.0PREDICTED: cyclic dof factor 3
TrEMBLA0A0A0LP470.0A0A0A0LP47_CUCSA; AOBP (Ascorbate oxidase promoter-binding protein)
STRINGGLYMA17G10920.31e-161(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-102cycling DOF factor 3